PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00098.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 344aa    MW: 39459.1 Da    PI: 7.0834
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00098.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W+  ++  g+ R++k+c++rw +yl
       KHN00098.1 14 KGPWTPEEDQKLFDYIQKHGYGNWRVLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.85.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++
       KHN00098.1  67 RGRFTLEEEETIIQLHSILGNK-WSAIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.85961IPR017930Myb domain
SuperFamilySSF466894.49E-3211108IPR009057Homeodomain-like
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-161461IPR001005SANT/Myb domain
CDDcd001671.28E-121661No hitNo description
PROSITE profilePS5129426.47562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.3E-1667111IPR001005SANT/Myb domain
CDDcd001672.93E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRSPCCDKN GLKKGPWTPE EDQKLFDYIQ KHGYGNWRVL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF TLEEEETIIQ LHSILGNKWS AIATRLPGRT DNEIKNYWNT HIRKRLLRMG  120
MDPVTHRPRL DLLDLSSILS SSLYGSTQMN IQRLLGTHTV VNPELLKLAS SLFPSQQREN  180
INMCAQNCEE NQLCDPQIQS QIPHDLAQEA LPFTHAQLVE SNTMNTYPSI FHESGFQQHY  240
SQLSDLHYNG IDHKSYVPQL PSYDYPPMSE SSTYNNSYNN SNQNFSYASV LSTPSSSPTP  300
LNSNSTFVKG SSSTEDETES YVSSNNLLRF EIPDMLRMNE YSYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312600.0KT031260.1 Glycine max clone HN_CCL_72 MYB/HD-like transcription factor (Glyma08g06440.1_like1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532563.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A0B2NXZ10.0A0A0B2NXZ1_GLYSO; Transcription factor MYB39
STRINGGLYMA08G06440.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-97MYB-like 102
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]